Recombinant Human TBCB

• Cat.No.: TBCB-27999TH
• Product Overview: Recombinant fragment of Human CKAP1 with N-terminal proprietary tag. Predicted MW 36.63 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• ProteinLength: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Tissue specificity: Found in most tissues.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: SLTIAEFKCKLELLVGSPASCMELELYGVDDKFYSKLDQEDALLGSYPVDDGCRIHVIDHSGARLGEYEDVSRVEKYTISQEAYDQRQDTVRSFLKRSKL
• Sequence Similarities: Belongs to the TBCB family.Contains 1 CAP-Gly domain.

Gene Information

• Gene Name: TBCB tubulin folding cofactor B [ Homo sapiens ]
• Official Symbol: TBCB
• Synonyms: TBCB; tubulin folding cofactor B; CKAP1, cytoskeleton associated protein 1 , cytoskeleton associated protein 1; tubulin-folding cofactor B; CG22; CKAPI
• Gene ID: 1155
• mRNA Refseq: NM_001281
• Protein Refseq: NP_001272
• MIM: 601303
• Uniprot ID: Q99426
• Chromosome Location: 19q13.11-q13.12
• Pathway: Metabolism of proteins, organism-specific biosystem; Post-chaperonin tubulin folding pathway, organism-specific biosystem; Protein folding, organism-specific biosystem
• Function: protein binding