Recombinant Human TAGLN3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: TAGLN3-3495H
• Product Overview: TAGLN3 MS Standard C13 and N15-labeled recombinant protein (NP_001008274) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: TAGLN3 (Transgelin 3) is a Protein Coding gene. Gene Ontology (GO) annotations related to this gene include actin filament binding. An important paralog of this gene is TAGLN2.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 22.5 kDa
• AA Sequence: MANRGPSYGLSREVQEKIEQKYDADLENKLVDWIILQCAEDIEHPPPGRAHFQKWLMDGTVLCKLINSLYPPGQEPIPKISESKMAFKQMEQISQFLKAAETYGVRTTDIFQTVDLWEGKDMAAVQRTLMALGSVAVTKDDGCYRGEPSWFHRKAQQNRRGFSEEQLRQGQNVIGLQMGSNKGASQAGMTGYGMPRQIMTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: TAGLN3 transgelin 3 [ Homo sapiens (human) ]
• Official Symbol: TAGLN3
• Synonyms: TAGLN3; transgelin 3; transgelin-3; NP22; NP25; neuronal protein 22; neuronal protein NP25
• Gene ID: 29114
• mRNA Refseq: NM_001008273
• Protein Refseq: NP_001008274
• MIM: 607953
• UniProt ID: Q9UI15