Recombinant Human TACSTD2 protein, His-tagged

• Cat.No.: TACSTD2-5633H
• Product Overview: Recombinant Human TACSTD2 protein(P09758)(27-274aa), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 27-274aa
• Tag: C-His
• Form: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
• Bio-activity: Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.7284-1.075 ng/mL.
• Molecular Mass: 30.6 kDa
• Endotoxin: Less than 1.0 EU/ug as determined by LAL method.
• Purity: Greater than 95% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Gene Information

• Gene Name: TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ]
• Official Symbol: TACSTD2
• Synonyms: TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; gastrointestinal tumor-associated antigen GA7331; membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; 40kD glycoprotein, identified by monoclonal GA733; EGP1; GP50; EGP-1; GA7331; GA733-1
• Gene ID: 4070
• mRNA Refseq: NM_002353
• Protein Refseq: NP_002344
• MIM: 137290
• UniProt ID: P09758