Recombinant Human TACSTD2 protein, His-tagged
Cat.No. : | TACSTD2-5633H |
Product Overview : | Recombinant Human TACSTD2 protein(P09758)(27-274aa), fused with C-terminal His tag, was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 27-274aa |
Tag : | C-His |
Form : | Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0 |
Bio-activity : | Measured by its binding ability in a functional ELISA. Immobilized Human TROP2 at 2 μg/mL can bind Anti-TROP2 recombinant antibody, the EC50 is 0.7284-1.075 ng/mL. |
Molecular Mass : | 30.6 kDa |
Endotoxin : | Less than 1.0 EU/ug as determined by LAL method. |
Purity : | Greater than 95% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT |
Gene Name | TACSTD2 tumor-associated calcium signal transducer 2 [ Homo sapiens ] |
Official Symbol | TACSTD2 |
Synonyms | TACSTD2; tumor-associated calcium signal transducer 2; M1S1; EGP 1; GA733 1; TROP2; epithelial glycoprotein-1; cell surface glycoprotein TROP2; cell surface glycoprotein Trop-2; pancreatic carcinoma marker protein GA7331; pancreatic carcinoma marker protein GA733-1; gastrointestinal tumor-associated antigen GA7331; membrane component chromosome 1 surface marker 1; membrane component, chromosome 1, surface marker 1; 40kD glycoprotein, identified by monoclonal GA733; EGP1; GP50; EGP-1; GA7331; GA733-1; |
Gene ID | 4070 |
mRNA Refseq | NM_002353 |
Protein Refseq | NP_002344 |
MIM | 137290 |
UniProt ID | P09758 |
◆ Recombinant Proteins | ||
TACSTD2-5053C | Recombinant Chicken TACSTD2 | +Inquiry |
TACSTD2-971R | Recombinant Rat TACSTD2 Protein (Met1-Gly270), His-tagged | +Inquiry |
TACSTD2-0769H | Active Recombinant Human TACSTD2 protein, Fc-tagged | +Inquiry |
TACSTD2-0768M | Recombinant Mouse TACSTD2 protein, His-tagged | +Inquiry |
TACSTD2-3292C | Recombinant Cynomolgus TACSTD2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TACSTD2-2546HCL | Recombinant Human TACSTD2 cell lysate | +Inquiry |
TACSTD2-1630MCL | Recombinant Mouse TACSTD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TACSTD2 Products
Required fields are marked with *
My Review for All TACSTD2 Products
Required fields are marked with *
0
Inquiry Basket