Recombinant Human SYN2

Cat.No. : SYN2-31489TH
Product Overview : Recombinant fragment of Human Synapsin II with N terminal proprietary tag, 36.74kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 101 amino acids
Description : This gene is a member of the synapsin gene family. Synapsins encode neuronal phosphoproteins which associate with the cytoplasmic surface of synaptic vesicles. Family members are characterized by common protein domains, and they are implicated in synaptogenesis and the modulation of neurotransmitter release, suggesting a potential role in several neuropsychiatric diseases. This member of the synapsin family encodes a neuron-specific phosphoprotein that selectively binds to small synaptic vesicles in the presynaptic nerve terminal. The TIMP4 gene is located within an intron of this gene and is transcribed in the opposite direction. Mutations in this gene may be associated with abnormal presynaptic function and schizophrenia. Alternative splicing of this gene results in two transcripts.
Molecular Weight : 36.740kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AMSDRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEV MDCSMPLIGEHQVEDRQLITELVISKMNQLLSRTPALSPQ RPLTTQQPQSGTLKDPDSSKT
Gene Name SYN2 synapsin II [ Homo sapiens ]
Official Symbol SYN2
Synonyms SYN2; synapsin II; synapsin-2; SYNII; SYNIIa; SYNIIb;
Gene ID 6854
mRNA Refseq NM_133625
Protein Refseq NP_598328
MIM 600755
Uniprot ID Q92777
Chromosome Location 3
Pathway Dopamine Neurotransmitter Release Cycle, organism-specific biosystem; Neuronal System, organism-specific biosystem; Neurotransmitter Release Cycle, organism-specific biosystem; Serotonin Neurotransmitter Release Cycle, organism-specific biosystem; Transmission across Chemical Synapses, organism-specific biosystem;
Function ATP binding; ligase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SYN2 Products

Required fields are marked with *

My Review for All SYN2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon