Description :	SVBP (Small Vasohibin Binding Protein) is a Protein Coding gene.
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	33.66 kDa
AA Sequence :	MDPPARKEKTKVKESVSRVEKAKQKSAQQELKQRQRAEIYALNRVMTELEQQQFDEFCKQMQPPGE
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	SVBP small vasohibin binding protein [ Homo sapiens (human) ]
Official Symbol	SVBP
Synonyms	SVBP; small vasohibin binding protein; CCDC23; Small Vasohibin Binding Protein; Coiled-Coil Domain Containing 23; Coiled-Coil Domain-Containing Protein 23; Coiled Coil Domain-Containing Protein 23; Small Vasohibin-Binding Protein
Gene ID	374969
mRNA Refseq	NM_199342
Protein Refseq	NP_955374
UniProt ID	Q8N300