Recombinant Human SV2C protein, GST-tagged

Cat.No. : SV2C-6813H
Product Overview : Recombinant Human SV2C protein(91-140 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 91-140 aa
Tag : N-GST
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : GEYQGIPSMNQAKDSIVSVGQPKGDEYKDRRELESERRADEEELAQQYEL
Gene Name SV2C synaptic vesicle glycoprotein 2C [ Homo sapiens ]
Official Symbol SV2C
Synonyms SV2C; synaptic vesicle glycoprotein 2C; synaptic vesicle protein 2C; MGC118874; MGC118875; MGC118876; MGC118877;
Gene ID 22987
mRNA Refseq NM_014979
Protein Refseq NP_055794
MIM 610291
UniProt ID Q496J9

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SV2C Products

Required fields are marked with *

My Review for All SV2C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon