Recombinant Human SUSD4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SUSD4-6002H
• Product Overview: SUSD4 MS Standard C13 and N15-labeled recombinant protein (NP_001032252) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SUSD4 (Sushi Domain Containing 4) is a Protein Coding gene. Diseases associated with SUSD4 include Chromosome 1Q41-Q42 Deletion Syndrome. An important paralog of this gene is CSMD2.
• Molecular Mass: 32.2 kDa
• AA Sequence: MYHGMNPSNGDGFLEQQQQQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGIPENGFRTPSGGVFFEGSVARFHCQDGFKLKGATKRLCLKHFNGTLGWIPSDNSICVQEDCRIPQIEDAEIHNKTYRHGEKLIITCHEGFKIRYPDLHNMVSLCRDDGTWNNLPICQGCLRPLASSNGYVNISELQTSFPVGTVISYRCFPGFKLDGSAYLECLQNLIWSSSPPRCLALEGGRPEHLFPVLYFPHIRLAAAVLYFCPVLKSSPTPAPTCSSTSTTTSLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SUSD4 sushi domain containing 4 [ Homo sapiens (human) ]
• Official Symbol: SUSD4
• Synonyms: SUSD4; sushi domain containing 4; sushi domain-containing protein 4; FLJ10052; YHGM196; PRO222; RP11-239E10.4
• Gene ID: 55061
• mRNA Refseq: NM_001037175
• Protein Refseq: NP_001032252
• MIM: 615827
• UniProt ID: Q5VX71