Recombinant Human SUPT4H1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SUPT4H1-6165H
Product Overview : SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene.
Molecular Mass : 13.2 kDa
AA Sequence : MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKTTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SUPT4H1 SPT4 homolog, DSIF elongation factor subunit [ Homo sapiens (human) ]
Official Symbol SUPT4H1
Synonyms SUPT4H1; suppressor of Ty 4 homolog 1 (S. cerevisiae); suppressor of Ty (S.cerevisiae) 4 homolog 1, SUPT4H; transcription elongation factor SPT4; SPT4H; hSPT4; DSIF p14; DSIF small subunit; DRB sensitivity-inducing factor small subunit; DRB sensitivity-inducing factor 14 kDa subunit; SPT4; SUPT4H;
Gene ID 6827
mRNA Refseq NM_003168
Protein Refseq NP_003159
MIM 603555
UniProt ID P63272

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SUPT4H1 Products

Required fields are marked with *

My Review for All SUPT4H1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon