Recombinant Human SUMO3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SUMO3-709H
• Product Overview: SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 11.6 kDa
• AA Sequence: MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSFTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SUMO3 small ubiquitin like modifier 3 [ Homo sapiens (human) ]
• Official Symbol: SUMO3
• Synonyms: SUMO3; SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 1, SMT3 suppressor of mif two 3 homolog 3 (yeast), SMT3H1; small ubiquitin-related modifier 3; SMT3A; SUMO-2; SMT3 homolog 1; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; SMT3 suppressor of mif two 3 homolog 1; Smt3B; SMT3H1; SUMO-3
• Gene ID: 6612
• mRNA Refseq: NM_006936
• Protein Refseq: NP_008867
• MIM: 602231
• UniProt ID: P55854