Recombinant Human SUMO2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SUMO2-2921H
• Product Overview: SUMO2 MS Standard C13 and N15-labeled recombinant protein (NP_001005849) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 7.9 kDa
• AA Sequence: MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQLEMEDEDTIDVFQQQTGGVYTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SUMO2 small ubiquitin like modifier 2 [ Homo sapiens (human) ]
• Official Symbol: SUMO2
• Synonyms: SUMO2; SMT3 suppressor of mif two 3 homolog 2 (S. cerevisiae); SMT3 (suppressor of mif two 3, yeast) homolog 2, SMT3 suppressor of mif two 3 homolog 2 (yeast), SMT3H2; small ubiquitin-related modifier 2; SMT3B; sentrin 2; SMT3 homolog 2; ubiquitin-like protein SMT3A; ubiquitin-like protein SMT3B; small ubiquitin-like modifier 2; HSMT3; SUMO3; Smt3A; SMT3H2; MGC117191
• Gene ID: 6613
• mRNA Refseq: NM_001005849
• Protein Refseq: NP_001005849
• MIM: 603042
• UniProt ID: P61956