Recombinant Human SULT2B1 protein, GST-tagged

• Cat.No.: SULT2B1-301465H
• Product Overview: Recombinant Human SULT2B1 (283-365 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn283-Ser365
• AA Sequence: NHFTVAQSEAFDRAYRKQMRGMPTFPWDEDPEEDGSPDPEPSPEPEPKPSLEPNTSLEREPRPNSSPSPSPGQASETPHPRPS
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: SULT2B1 sulfotransferase family, cytosolic, 2B, member 1 [ Homo sapiens ]
• Official Symbol: SULT2B1
• Synonyms: SULT2B1; sulfotransferase family, cytosolic, 2B, member 1; sulfotransferase family cytosolic 2B member 1; HSST2; ST2B1; sulfotransferase 2B1; alcohol sulfotransferase; hydroxysteroid sulfotransferase 2
• Gene ID: 6820
• mRNA Refseq: NM_004605
• Protein Refseq: NP_004596
• MIM: 604125
• UniProt ID: O00204