Recombinant Human SULT1C2, His-tagged

Cat.No. : SULT1C2-30914TH
Product Overview : Recombinant full length Human SULT1C2 (amino acids 1-296) with an N terminal His tag; 316aa, 37kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 296 amino acids
Description : Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that belongs to the SULT1 subfamily, responsible for transferring a sulfo moiety from PAPS to phenol-containing compounds. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.
Conjugation : HIS
Molecular Weight : 37.000kDa inclusive of tags
Tissue specificity : Found in adult stomach, kidney and thyroid gland, and in fetal kidney and liver.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM DTT, pH 8.0
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMALTSDLGKQIKLKEVEGTLLQPATVDNWSQIQSFEAKPDDLLICTYPKAGTTWIQEIVDMIEQNGDVEKCQRAIIQHRHPFIEWARPPQPSGVEKAKAMPSPRILKTHLSTQLLPPSFWENNCKFLYVARNAKDCMVSYYHFQRMNHMLPDPGTWEEYFETFINGKVVWGSWFDHVKGWWEMKDRHQILFLFYEDIKRDPKHEIRKVMQFMGKKVDETVLDKIVQETSFEKMKENPMTNRSTVSKSILDQSISSFMRKGTVGDWKNHFTVAQNERFDEIYRRKMEGTSINFCMEL
Sequence Similarities : Belongs to the sulfotransferase 1 family.
Gene Name SULT1C2 sulfotransferase family, cytosolic, 1C, member 2 [ Homo sapiens ]
Official Symbol SULT1C2
Synonyms SULT1C2; sulfotransferase family, cytosolic, 1C, member 2; sulfotransferase family, cytosolic, 1C, member 1 , SULT1C1; sulfotransferase 1C2; ST1C1;
Gene ID 6819
mRNA Refseq NM_001056
Protein Refseq NP_001047
MIM 602385
Uniprot ID O00338
Chromosome Location 2q12.3
Pathway Biological oxidations, organism-specific biosystem; Cytosolic sulfonation of small molecules, organism-specific biosystem; Metabolism, organism-specific biosystem; Phase II conjugation, organism-specific biosystem;
Function sulfotransferase activity; transferase activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SULT1C2 Products

Required fields are marked with *

My Review for All SULT1C2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon