Recombinant Human STX8 Protein

Description :	Vesicle trafficking protein that functions in the early secretory pathway, possibly by mediating retrograde transport from cis-Golgi membranes to the ER.
Source :	E. coli
Form :	Lyophilized from a 0.2 µM filtered solution of PBS, pH 7.4
Molecular Mass :	24.6kD
AA Sequence :	MAPDPWFSTYDSTCQIAQEIAEKIQQRNQYERKGEKAPKLTVTIRALLQNLKEKIALLKDLLLRAVSTHQITQLEGDRRQNLLDDLVTRERLLLASFKNEGAEPDLIRSSLMSEEAKRGAPNPWLFEEPEETRGLGFDEIRQQQQKIIQEQDAGLDALSSIISRQKQMGQEIGNELDEQNEIIDDLANLVENTDEKLRNETRRVNMVDRKSASCG
Endotoxin :	Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity :	>95% as determined by SDS-PAGE and Coomassie blue staining
Concentration :	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Tag :	Non

Gene Name	STX8 syntaxin 8 [ Homo sapiens ]
Official Symbol	STX8
Synonyms	STX8; syntaxin 8; syntaxin-8; CARB; CIP-1-associated regulator of cyclin B;
Gene ID	9482
mRNA Refseq	NM_004853
Protein Refseq	NP_004844
MIM	604203
UniProt ID	Q9UNK0