Recombinant Human STT3A Protein, GST-tagged

• Cat.No.: STT3A-4957H
• Product Overview: Human ITM1 partial ORF ( NP_689926, 603 a.a. - 701 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a catalytic subunit of the N-oligosaccharyltransferase (OST) complex, which functions in the endoplasmic reticulum to transfer glycan chains to asparagine residues of target proteins. A separate complex containing a similar catalytic subunit with an overlapping function also exists. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
• Molecular Mass: 36.63 kDa
• AA Sequence: GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: STT3A
• Synonyms: STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC; B5; transmembrane conserved; transmembrane protein TMC; integral membrane protein 1; integral transmembrane protein 1; oligosaccharyl transferase subunit STT3A; ITM1; STT3-A; FLJ27038
• Gene ID: 3703
• mRNA Refseq: NM_152713
• Protein Refseq: NP_689926
• MIM: 601134
• UniProt ID: P46977