Recombinant Human STT3A Protein, GST-tagged

Description :	The protein encoded by this gene is a catalytic subunit of the N-oligosaccharyltransferase (OST) complex, which functions in the endoplasmic reticulum to transfer glycan chains to asparagine residues of target proteins. A separate complex containing a similar catalytic subunit with an overlapping function also exists. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2015]
Source :	Wheat Germ
Species :	Human
Tag :	GST
Molecular Mass :	36.63 kDa
AA Sequence :	GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG
Applications :	Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array
Notes :	Best use within three months from the date of receipt of this protein.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Name	STT3A STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae) [ Homo sapiens ]
Official Symbol	STT3A
Synonyms	STT3A; STT3, subunit of the oligosaccharyltransferase complex, homolog A (S. cerevisiae); integral membrane protein 1 , ITM1; dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A; MGC9042; STT3 A; TMC; B5; transmembrane conserved; transmembrane protein TMC; integral membrane protein 1; integral transmembrane protein 1; oligosaccharyl transferase subunit STT3A; ITM1; STT3-A; FLJ27038;
Gene ID	3703
mRNA Refseq	NM_152713
Protein Refseq	NP_689926
MIM	601134
UniProt ID	P46977