Recombinant Human STK4 protein(301-480 aa), C-His-tagged

• Cat.No.: STK4-2841H
• Product Overview: Recombinant Human STK4 protein(Q13043)(301-480 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 301-480 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KLKRQESQQREVDQDDEENSEEDEMDSGTMVRAVGDEMGTVRVASTMTDGANTMIEHDDTLPSQLGTMVINAEDEEEEGTMKRRDETMQPAKPSFLEYFEQKEKENQINSFGKSVPGPLKNSSDWKIPQDGDYEFLKSWTVEDLQKRLLALDPMMEQEIEEIRQKYQSKRQPILDAIEAK

Gene Information

• Gene Name: STK4 serine/threonine kinase 4 [ Homo sapiens ]
• Official Symbol: STK4
• Synonyms: STK4; serine/threonine kinase 4; serine/threonine-protein kinase 4; kinase responsive to stress 2; KRS2; mammalian sterile 20 like 1; MST1; yeast Ste20 like; YSK3; MST-1; STE20-like kinase MST1; mammalian sterile 20-like 1; mammalian STE20-like protein kinase 1; serine/threonine-protein kinase Krs-2; dJ211D12.2 (serine/threonine kinase 4 (MST1, KRS2)); DKFZp686A2068
• Gene ID: 6789
• mRNA Refseq: NM_006282
• Protein Refseq: NP_006273
• MIM: 604965
• UniProt ID: Q13043