Recombinant Human STC1 Protein, GST-tagged
Cat.No. : | STC1-1377H |
Product Overview : | Recombinant Human STC1 Protein (39-247aa) was expressed in E. coli with N-terminal GST tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 39-247 a.a. |
Form : | Tris-based buffer, 50% glycerol. |
Molecular Mass : | 50.6 kDa |
AA Sequence : | SAEVVRCLNSALQVGCGAFACLENSTCDTDGMYDICKSFLYSAAKFDTQGKAFVKESLKCIANGVTSKVF LAIRRCSTFQRMIAEVQEECYSKLNVCSIAKRNPEAITEVVQLPNHFSNRYYNRLVRSLLECDEDTVSTI RDSLMEKIGPNMASLFHILQTDHCAQTHPRADFNRRRTNEPQKLKVLLRNLRGEEDSPSHIKRTSHESA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | The shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Gene Name | STC1 stanniocalcin 1 [ Homo sapiens ] |
Official Symbol | STC1 |
Synonyms | STC1; stanniocalcin 1; STC; stanniocalcin-1 |
Gene ID | 6781 |
mRNA Refseq | NM_003155 |
Protein Refseq | NP_003146 |
MIM | 601185 |
UniProt ID | P52823 |
◆ Recombinant Proteins | ||
STC1-4401Z | Recombinant Zebrafish STC1 | +Inquiry |
STC1-01H | Active Recombinant Human STC1 Protein, His-tagged | +Inquiry |
STC1-5442R | Recombinant Rat STC1 Protein, His (Fc)-Avi-tagged | +Inquiry |
STC1-16117M | Recombinant Mouse STC1 Protein | +Inquiry |
STC1-3535H | Recombinant Human STC1 protein, His-SUMO-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STC1-1412HCL | Recombinant Human STC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STC1 Products
Required fields are marked with *
My Review for All STC1 Products
Required fields are marked with *
0
Inquiry Basket