Recombinant Human STAT6, His-tagged

• Cat.No.: STAT6-30854TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1-287 of Human STAT6 with N terminal His tag; 287 amino acids, 33kDa.

Specification

• Description: The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 147 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWE FLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTIL QHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRH LPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAE AGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAK ALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLV DIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVT SCFLVEKQPPQVLKTQT
• Sequence Similarities: Belongs to the transcription factor STAT family.Contains 1 SH2 domain.
• Protein length: 1-287 a.a.

Gene Information

• Gene Name: STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ]
• Official Symbol: STAT6
• Synonyms: STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT
• Gene ID: 6778
• mRNA Refseq: NM_001178078
• Protein Refseq: NP_001171549
• MIM: 601512
• Uniprot ID: P42226
• Chromosome Location: 12q13
• Pathway: Adipogenesis, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem
• Function: calcium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity