Recombinant Human STAT6, His-tagged
Cat.No. : | STAT6-30854TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-287 of Human STAT6 with N terminal His tag; 287 amino acids, 33kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-287 a.a. |
Description : | The protein encoded by this gene is a member of the STAT family of transcription factors. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein plays a central role in exerting IL4 mediated biological responses. It is found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL4. Knockout studies in mice suggested the roles of this gene in differentiation of T helper 2 (Th2) cells, expression of cell surface markers, and class switch of immunoglobulins. Alternative splicing results in multiple transcript variants. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 147 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium hydrogen phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWE FLVGSDAFCCNLASALLSDTVQHLQASVGEQGEGSTIL QHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRH LPMPFHWKQEELKFKTGLRRLQHRVGEIHLLREALQKGAE AGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAK ALVLKRIQIWKRQQQLAGNGAPFEESLAPLQERCESLV DIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVT SCFLVEKQPPQVLKTQT |
Sequence Similarities : | Belongs to the transcription factor STAT family.Contains 1 SH2 domain. |
Gene Name | STAT6 signal transducer and activator of transcription 6, interleukin-4 induced [ Homo sapiens ] |
Official Symbol | STAT6 |
Synonyms | STAT6; signal transducer and activator of transcription 6, interleukin-4 induced; signal transducer and activator of transcription 6; D12S1644; IL 4 STAT; |
Gene ID | 6778 |
mRNA Refseq | NM_001178078 |
Protein Refseq | NP_001171549 |
MIM | 601512 |
Uniprot ID | P42226 |
Chromosome Location | 12q13 |
Pathway | Adipogenesis, organism-specific biosystem; Downstream signal transduction, organism-specific biosystem; IL-3 Signaling Pathway, organism-specific biosystem; IL-4 signaling Pathway, organism-specific biosystem; IL12-mediated signaling events, organism-specific biosystem; |
Function | calcium ion binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
STAT6-151H | Recombinant Human STAT6 Protein, His-tagged | +Inquiry |
STAT6-6368H | Recombinant Human STAT6 Protein (Ser627-Ser837), C-His tagged | +Inquiry |
STAT6-888HFL | Recombinant Full Length Human STAT6 Protein, C-Flag-tagged | +Inquiry |
STAT6-7039H | Recombinant Human STAT6, His tagged | +Inquiry |
Stat6-4312R | Recombinant Rat Stat6 Protein (Gly557-Trp841), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT6-481HCL | Recombinant Human STAT6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT6 Products
Required fields are marked with *
My Review for All STAT6 Products
Required fields are marked with *
0
Inquiry Basket