Recombinant Human STAT5a, His-tagged
Cat.No. : | STAT5A-01H |
Product Overview : | A DNA sequence encoding Human STAT5A ( a.a.129-712 ) was fused with a His tag . |
Availability | March 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 129-712 a.a. |
Form : | 20 mM Tris-HCl, 200 mM NaCl, pH7.4 |
Molecular Mass : | ~67kDa |
AA Sequence : | PAGILVDAMSQKHLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETA LQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSW CEKLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAATVR LLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMSLKRIKRAD RRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVL WPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVM EVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSI RSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASAD |
Purity : | >92% as determined by SDS-PAGE |
Storage : | Short Term Storage +4°C. Long Term Storage -20°C. Prepare aliquots and store at -20°C. Avoid freeze/thaw cycles. |
Gene Name | STAT5A signal transducer and activator of transcription 5A [ Homo sapiens ] |
Official Symbol | STAT5A |
Synonyms | STAT5A; signal transducer and activator of transcription 5A; STAT5; MGF; |
Gene ID | 6776 |
mRNA Refseq | NM_003152 |
Protein Refseq | NP_003143 |
MIM | 601511 |
UniProt ID | P42229 |
Chromosome Location | 17q11.2 |
Pathway | Acute myeloid leukemia, organism-specific biosystem; Acute myeloid leukemia, conserved biosystem; Adipogenesis, organism-specific biosystem; Angiopoietin receptor Tie2-mediated signaling, organism-specific biosystem; CD40/CD40L signaling, organism-specific biosystem; CXCR4-mediated signaling events, organism-specific biosystem; Chronic myeloid leukemia, organism-specific biosystem; |
Function | RNA polymerase II core promoter sequence-specific DNA binding; calcium ion binding; double-stranded DNA binding; protein binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
STAT5A-9737Z | Recombinant Zebrafish STAT5A | +Inquiry |
STAT5A-340H | Recombinant Human STAT5A protein, His/MBP-tagged | +Inquiry |
STAT5A-341H | Recombinant Human STAT5A protein, His/MBP-tagged | +Inquiry |
STAT5A-0729H | Recombinant Human STAT5A protein, His-tagged | +Inquiry |
STAT5A-4962H | Recombinant Human STAT5A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT5A-1416HCL | Recombinant Human STAT5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT5A Products
Required fields are marked with *
My Review for All STAT5A Products
Required fields are marked with *
0
Inquiry Basket