Recombinant Human STAT1, no tag
Cat.No. : | STAT1-73H |
Product Overview : | Recombinant Human Signal Transducer and Activator of Transcription 1-Alpha/Beta/STAT1 is produced with our E. coli expression system. The target protein is expressed with sequence (Met1-Val712) of Human STAT1. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 1-712 a.a. |
Description : | The protein encoded by this gene is a member of the STAT protein family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. This protein can be activated by various ligands including interferon-alpha, interferon-gamma, EGF, PDGF and IL6. This protein mediates the expression of a variety of genes, which is thought to be important for cell viability in response to different cell stimuli and pathogens. Two alternatively spliced transcript variants encoding distinct isoforms have been described. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS, pH 7.4 |
AA Sequence : | GSHMSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLS QLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQS GNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQ KQEQLLLKKMYLMLDNKRKEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLD QLQNWFTIVAESLQQVRQQLKKLEELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQ PCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHT KVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTNEGPLIVTEELHSLSFETQLCQPGLVIDLETTS LPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTPPCARWAQLSEVLSWQFSSVTKRGLNVD QLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIESILELIKKHLLPLWNDGCIMGFI SKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHAVEPYTKKELSAVTFPDI IRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEV |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | STAT1 signal transducer and activator of transcription 1, 91kDa [ Homo sapiens (human) ] |
Official Symbol | STAT1 |
Synonyms | STAT1; signal transducer and activator of transcription 1, 91kDa; transcription factor ISGF-3 components p91/p84; Signal transducer and activator of transcription 1-alpha/beta; ISGF-3; STAT91; DKFZp686B04100; signal transducer and activator of transcription 1; OTTHUMP00000205845; signal transducer and activator of transcription-1; OTTHUMP00000165047; Transcription factor ISGF-3 components p91/p84 |
Gene ID | 6772 |
mRNA Refseq | NM_007315 |
Protein Refseq | NP_009330 |
MIM | 600555 |
UniProt ID | P42224 |
Chromosome Location | 2q32.2 |
Pathway | Chemokine signaling pathway; Jak-STAT signaling pathway; Pancreatic cancer; Pathways in cancer; Toll-like receptor signaling pathway; Signaling by PDGF |
Function | calcium ion binding; hematopoietin/interferon-class (D200-domain) cytokine receptor signal transducer activity; protein binding; sequence-specific DNA binding; signal transducer activity; transcription factor activity |
◆ Recombinant Proteins | ||
STAT1-8473H | Active Recombinant Human STAT1, His-tagged | +Inquiry |
STAT1-2783H | Recombinant Human STAT1, His-tagged | +Inquiry |
STAT1-30902TH | Recombinant Human STAT1 | +Inquiry |
STAT1-01H | Recombinant Human STAT1 Protein, GST-tagged | +Inquiry |
Stat1-6168M | Recombinant Mouse Stat1 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
STAT1-555HCL | Recombinant Human STAT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All STAT1 Products
Required fields are marked with *
My Review for All STAT1 Products
Required fields are marked with *
0
Inquiry Basket