Recombinant Human ST6GALNAC6 Protein (AA 33-333), N-6×His/GFP tagged

• Cat.No.: ST6GALNAC6-18H
• Product Overview: Recombinant Human ST6GALNAC6 Protein (AA 33-333) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Description: ST6GALNAC6 belongs to a family of sialyltransferases that modify proteins and ceramides on the cell surface to alter cell-cell or cell-extracellular matrix interactions (Tsuchida et al., 2003 [PubMed 12668675]).
• Source: HEK293
• Species: Human
• Tag: His&GFP
• Protein length: AA 33-333
• AA Sequence: REMSSNKEQRSAVFVILFALITILILYSSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLPSRCHQCVIVSSSSHLLGTKLGPEIERAECTIRMNDAPTTGYSADVGNKTTYRVVAHSSVFRVLRRPQEFVNRTPETVFIFWGPPSKMQKPQGSLVRVIQRAGLVFPNMEAYAVSPGRMRQFDDLFRGETGKDREKSHSWLSTGWFTMVIAVELCDHVHVYGMVPPNYCSQRPRLQRMPYHYYEPKGPDECVTYIQNEHSRKGNHHRFITEKRVFSSWAQLYGITFSHPSWT
• Purity: >95%, by SDS-PAGE as visualized by Coomassie Blue Staining
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: ST6GALNAC6 ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6 [ Homo sapiens (human) ]
• Official Symbol: ST6GALNAC6
• Synonyms: ST6GALNAC6; ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; sialytransferase 7 ((alpha N acetylneuraminyl 2,3 betagalactosyl 1,3) N acetyl galactosaminide alpha 2,6 sialytransferase) F , SIAT7F; alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6; ST6GALNACVI; SIAT7-F; ST6GalNAc VI; hST6GalNAc VI; sialyltransferase 7F; galNAc alpha-2,6-sialyltransferase VI; CMP-NeuAC:(beta)-N-acetylgalactosaminide (alpha)2,6-sialyltransferase member VI; sialytransferase 7 ((alpha-N-acetylneuraminyl 2,3-betagalactosyl-1,3)-N-acetyl galactosaminide alpha-2,6-sialytransferase) F; SIAT7F; RP11-203J24.3
• Gene ID: 30815
• mRNA Refseq: NM_013443
• Protein Refseq: NP_038471
• MIM: 610135
• UniProt ID: Q969X2