Recombinant Human ST6GAL1 Full Length Transmembrane protein (1-406 aa), His-tagged

• Cat.No.: ST6GAL1-2720H
• Product Overview: Recombinant Human ST6GAL1 Protein (1-406 aa) is produced by in vitro E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal.

Specification

• Source: In vitro E. coli expression system
• Species: Human
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 52.1kDa
• Protein length: 1-406aa
• AA Sequence: MIHTNLKKKFSCCVLVFLLFAVICVWKEKKKGSYYDSFKLQTKEFQVLKSLGKLAMGSDSQSVSSSSTQDPHRGRQTLGSLRGLAKAKPEASFQVWNKDSSSKNLIPRLQKIWKNYLSMNKYKVSYKGPGPGIKFSAEALRCHLRDHVNVSMVEVTDFPFNTSEWEGYLPKESIRTKAGPWGRCAVVSSAGSLKSSQLGREIDDHDAVLRFNGAPTANFQQDVGTKTTIRLMNSQLVTTEKRFLKDSLYNEGILIVWDPSVYHSDIPKWYQNPDYNFFNNYKTYRKLHPNQPFYILKPQMPWELWDILQEISPEEIQPNPPSSGMLGIIIMMTLCDQVDIYEFLPSKRKTDVCYYYQKFFDSACTMGAYHPLLYEKNLVKHLNQGTDEDIYLLGKATLPGFRTIHC
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: ST6GAL1 ST6 beta-galactosamide alpha-2,6-sialyltranferase 1 [ Homo sapiens ]
• Official Symbol: ST6GAL1
• Synonyms: ST6GAL1; ST6 beta-galactosamide alpha-2,6-sialyltranferase 1; sialyltransferase 1 (beta galactoside alpha 2,6 sialytransferase) , SIAT1; beta-galactoside alpha-2,6-sialyltransferase 1; ST6Gal I; alpha 2,6-ST 1; B-cell antigen CD75; sialyltransferase 1 (beta-galactoside alpha-2,6-sialyltransferase); CMP-N-acetylneuraminate beta-galactosamide alpha-2,6-sialyltransferase; CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,6-sialyltransferase 1; ST6N; SIAT1; ST6GalI; MGC48859
• Gene ID: 6480
• mRNA Refseq: NM_003032
• Protein Refseq: NP_003023
• MIM: 109675
• UniProt ID: P15907