Recombinant Human SSR1
Cat.No. : | SSR1-31606TH |
Product Overview : | Recombinant fragment of Human TRAP alpha with N-terminal proprietary tag, 54.05 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 254 amino acids |
Description : | The signal sequence receptor (SSR) is a glycosylated endoplasmic reticulum (ER) membrane receptor associated with protein translocation across the ER membrane. The SSR consists of 2 subunits, a 34-kD glycoprotein encoded by this gene and a 22-kD glycoprotein. This gene generates several mRNA species as a result of complex alternative polyadenylation. This gene is unusual in that it utilizes arrays of polyA signal sequences that are mostly non-canonical. |
Molecular Weight : | 54.050kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QDLTEDEETVEDSIIEDEDDEAEVEEDEPTDLVEDKEEED VSGEPEASPSADTTILFVKGEDFPANNIVKFLVGFTNKGT EDFIVESLDASFRYPQDYQFYIQNFTALPLNTVVPPQRQA TFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQ TVTVIEREDGLDGETIFMYMFLAGLGLLVIVGLHQLLESR KRKRPIQKVEMGTSSQNDVDMSWIPQETLNQINKASPRRL PRKRAQKRSVGSDE |
Sequence Similarities : | Belongs to the TRAP-alpha family. |
Gene Name | SSR1 signal sequence receptor, alpha [ Homo sapiens ] |
Official Symbol | SSR1 |
Synonyms | SSR1; signal sequence receptor, alpha; translocon-associated protein subunit alpha; translocon associated protein alpha; TRAPA; |
Gene ID | 6745 |
mRNA Refseq | NM_003144 |
Protein Refseq | NP_003135 |
MIM | 600868 |
Uniprot ID | P43307 |
Chromosome Location | 6p24.3 |
Pathway | Activation of Chaperones by IRE1alpha, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Protein processing in endoplasmic reticulum, organism-specific biosystem; Protein processing in endoplasmic reticulum, conserved biosystem; |
Function | signal sequence binding; |
◆ Cell & Tissue Lysates | ||
SSR1-1459HCL | Recombinant Human SSR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SSR1 Products
Required fields are marked with *
My Review for All SSR1 Products
Required fields are marked with *
0
Inquiry Basket