Recombinant Human SRXN1 protein, His-tagged

Cat.No. : SRXN1-7855H
Product Overview : Recombinant Human SRXN1 protein(1-137 aa), fused with N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Tag : N-His
ProteinLength : 1-137 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : MGLRAGGTLGRAGAGRGAPEGPGPSGGAQGGSIHSGRIAAVHNVPLSVLIRPLPSVLDPAKVQSLVDTIREDPDSVPPIDVLWIKGAQGGDYFYSFGGCHRYAAYQQLQRETIPAKLVQSTLSDLRVYLGASTPDLQ
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name SRXN1 sulfiredoxin 1 [ Homo sapiens ]
Official Symbol SRXN1
Synonyms SRXN1; sulfiredoxin 1; C20orf139, chromosome 20 open reading frame 139 , sulfiredoxin 1 homolog (S. cerevisiae); sulfiredoxin-1; dJ850E9.2; Npn3; SRX1; YKL086W; sulfiredoxin 1 homolog; C20orf139; FLJ43353;
Gene ID 140809
mRNA Refseq NM_080725
Protein Refseq NP_542763
UniProt ID Q9BYN0

Not For Human Consumption!

Inquiry

0

Inquiry Basket

cartIcon