Recombinant Human SRSF10 Protein (1-183 aa), His-SUMO-tagged

• Cat.No.: SRSF10-990H
• Product Overview: Recombinant Human SRSF10 Protein (1-183 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Epigenetics and Nuclear Signaling. Protein Description: Full Length of Isoform 3.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-183 aa
• Description: Splicing factor that in its dephosphorylated form acts as a general repressor of pre-mRNA splicing. Ses to interfere with the U1 snRNP 5'-splice recognition of SNRNP70. Required for splicing repression in M-phase cells and after heat shock. May be involved in regulation of alternative splicing in neurons, with isoform 1 acting as a positive and isoform 3 as a negative regulator.
• Form: Tris-based buffer, 50% glycerol
• Molecular Mass: 38.2 kDa
• AA Sequence: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRRSYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with concentration instruction is sent along with the products.

Gene Information

• Gene Name: SRSF10 serine/arginine-rich splicing factor 10 [ Homo sapiens ]
• Official Symbol: SRSF10
• Synonyms: SRSF10; NSSR; SFRS13; SRp38; SRrp40; TASR1; TASR2; TASR; FUSIP1; FUSIP2; SFRS13A; FLJ30749; FLJ43846; DKFZp686H0644
• Gene ID: 10772
• mRNA Refseq: NM_001191005
• Protein Refseq: NP_001177934
• MIM: 605221
• UniProt ID: O75494