Recombinant Human SRPRB Protein, Flag-tagged

• Cat.No.: SRPRB-2257H
• Product Overview: Recombinant Human SRPRB Protein is produced by HEK293T expression system. This protein is fused with a Flag tag.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Description: The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
• Form: PBS buffer
• Molecular Mass: 30 kDa
• AA Sequence: MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: SRPRB SRP receptor subunit beta [ Homo sapiens (human)]
• Official Symbol: SRPRB
• Synonyms: APMCF1; APMCF1
• Gene ID: 58477
• mRNA Refseq: NM_021203
• Protein Refseq: NP_067026
• UniProt ID: Q9Y5M8