Recombinant Human SRPRB Protein, Flag-tagged
| Cat.No. : | SRPRB-2257H |
| Product Overview : | Recombinant Human SRPRB Protein is produced by HEK293T expression system. This protein is fused with a Flag tag. |
- Specification
- Gene Information
- Related Products
- Download
| Description : | The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane. |
| Source : | HEK293T |
| Species : | Human |
| Tag : | Flag |
| Form : | PBS buffer |
| Molecular Mass : | 30 kDa |
| AA Sequence : | MASADSRRLADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDSGKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQREVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIASGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | SRPRB SRP receptor subunit beta [ Homo sapiens (human)] |
| Official Symbol | SRPRB |
| Synonyms | APMCF1; APMCF1 |
| Gene ID | 58477 |
| mRNA Refseq | NM_021203 |
| Protein Refseq | NP_067026 |
| UniProt ID | Q9Y5M8 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRPRB Products
Required fields are marked with *
My Review for All SRPRB Products
Required fields are marked with *
0
Inquiry Basket
