Recombinant Human SRP54 protein(181-250 aa), C-His-tagged

• Cat.No.: SRP54-2798H
• Product Overview: Recombinant Human SRP54 protein(P61011)(181-250 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 181-250 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKL

Gene Information

• Gene Name: SRP54 signal recognition particle 54kDa [ Homo sapiens ]
• Official Symbol: SRP54
• Synonyms: SRP54; signal recognition particle 54kDa; signal recognition particle 54kD; signal recognition particle 54 kDa protein
• Gene ID: 6729
• mRNA Refseq: NM_001146282
• Protein Refseq: NP_001139754
• MIM: 604857
• UniProt ID: P61011