Recombinant Human SRP54 protein(181-250 aa), C-His-tagged
Cat.No. : | SRP54-2798H |
Product Overview : | Recombinant Human SRP54 protein(P61011)(181-250 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181-250 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKL |
Gene Name | SRP54 signal recognition particle 54kDa [ Homo sapiens ] |
Official Symbol | SRP54 |
Synonyms | SRP54; signal recognition particle 54kDa; signal recognition particle 54kD; signal recognition particle 54 kDa protein; |
Gene ID | 6729 |
mRNA Refseq | NM_001146282 |
Protein Refseq | NP_001139754 |
MIM | 604857 |
UniProt ID | P61011 |
◆ Recombinant Proteins | ||
SRP54-3529H | Recombinant Human SRP54 protein, His-B2M-tagged | +Inquiry |
SRP54-0433H | Recombinant Human SRP54 Protein (Asn2-Met504), N-His-tagged | +Inquiry |
SRP54-4468R | Recombinant Rhesus monkey SRP54 Protein, His-tagged | +Inquiry |
SRP54-977C | Recombinant Cynomolgus SRP54 Protein, His-tagged | +Inquiry |
SRP54-388HFL | Active Recombinant Full Length Human SRP54 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SRP54-632HCL | Recombinant Human SRP54 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SRP54 Products
Required fields are marked with *
My Review for All SRP54 Products
Required fields are marked with *
0
Inquiry Basket