Recombinant Human SRP54 protein(181-250 aa), C-His-tagged

Cat.No. : SRP54-2798H
Product Overview : Recombinant Human SRP54 protein(P61011)(181-250 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E. coli
Species : Human
Tag : His
Protein length : 181-250 aa
Form : 0.15 M Phosphate buffered saline
AASequence : NENFEIIIVDTSGRHKQEDSLFEEMLQVANAIQPDNIVYVMDASIGQACEAQAKAFKDKVDVASVIVTKL
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
Gene Name SRP54 signal recognition particle 54kDa [ Homo sapiens ]
Official Symbol SRP54
Synonyms SRP54; signal recognition particle 54kDa; signal recognition particle 54kD; signal recognition particle 54 kDa protein;
Gene ID 6729
mRNA Refseq NM_001146282
Protein Refseq NP_001139754
MIM 604857
UniProt ID P61011

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SRP54 Products

Required fields are marked with *

My Review for All SRP54 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon