Recombinant Human SRGN protein(81-150 aa), C-His-tagged

• Cat.No.: SRGN-2624H
• Product Overview: Recombinant Human SRGN protein(P10124)(81-150 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: His
• Protein length: 81-150 aa
• Form: 0.15 M Phosphate buffered saline
• AASequence: QDLNRIFPLSEDYSGSGFGSGSGSGSGSGSGFLTEMEQDYQLVDESDAFHDNLRSLDRNLPSDSQDLGQH
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: SRGN serglycin [ Homo sapiens ]
• Official Symbol: SRGN
• Synonyms: SRGN; serglycin; PRG, PRG1, proteoglycan 1, secretory granule; PPG; serglycin proteoglycan; p.PG; proteoglycan 1, secretory granule; platelet proteoglycan core protein; hematopoetic proteoglycan core peptide; hematopoetic proteoglycan core protein; secretory granule proteoglycan core peptide; secretory granule proteoglycan core protein; proteoglycan protein core for mast cell secretory granule; PRG; PRG1; MGC9289; FLJ12930
• Gene ID: 5552
• mRNA Refseq: NM_002727
• Protein Refseq: NP_002718
• MIM: 177040
• UniProt ID: P10124