Recombinant Human SPSB2 Protein, GST-tagged

• Cat.No.: SPSB2-5319H
• Product Overview: Human GRCC9 partial ORF ( AAH02983, 1 a.a. - 90 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes encodes a suppressor of cytokine signaling (SOCS) family member, and it belongs to the subfamily of proteins containing a central SPRY (repeats in splA and RyR) domain and a C-terminal SOCS box. This gene is present in a gene-rich cluster on chromosome 12p13 in the vicinity of the CD4 antigen and triosephosphate isomerase genes. Alternative splicing results in multiple transcript variants. [provided by RefSeq
• Molecular Mass: 35.64 kDa
• AA Sequence: MGQTALAGGSSSTPTPQALYPDLSCPEGLEELLSAPPPDLGAQRRHGWNPKDCSENIEVKEGGLYFERRPVAQSTDGARGKRGYSRGLHA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SPSB2 splA/ryanodine receptor domain and SOCS box containing 2 [ Homo sapiens ]
• Official Symbol: SPSB2
• Synonyms: SPSB2; splA/ryanodine receptor domain and SOCS box containing 2; SPRY domain-containing SOCS box protein 2; GRCC9; SSB 2; gene-rich cluster protein C9; SPRY domain-containing SOCS box protein SSB-2; SSB2; MGC2519; FLJ17395
• Gene ID: 84727
• mRNA Refseq: NM_001146316
• Protein Refseq: NP_001139788
• MIM: 611658
• UniProt ID: Q99619