Recombinant Human SPCS2 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPCS2-4411H
• Product Overview: SPCS2 MS Standard C13 and N15-labeled recombinant protein (NP_055567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Component of the microsomal signal peptidase complex which removes signal peptides from nascent proteins as they are translocated into the lumen of the endoplasmic reticulum.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 25 kDa
• AA Sequence: MAAAAVQGGRSGGSGGCSGAGGASNCGTGSGRSGLLDKWKIDDKPVKIDKWDGSAVKNSLDDSAKKVLLEKYKYVENFGLIDGRLTICTISCFFAIVALIWDYMHPFPESKPVLALCVISYFVMMGILTIYTSYKEKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKLTFISGRTKQQREAEFTKSIAKFFDHSGTLVMDAYEPEISRLHDSLAIERKIKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPCS2 signal peptidase complex subunit 2 [ Homo sapiens (human) ]
• Official Symbol: SPCS2
• Synonyms: SPCS2; signal peptidase complex subunit 2; signal peptidase complex subunit 2; SPase 25 kDa subunit; microsomal signal peptidase 25 kDa subunit; signal peptidase 25kDa subunit; signal peptidase complex subunit 2 homolog; EC 3.4.-.-
• Gene ID: 9789
• mRNA Refseq: NM_014752
• Protein Refseq: NP_055567
• UniProt ID: Q15005