Recombinant Human SPCS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPCS1-6268H
• Product Overview: SPCS1 MS Standard C13 and N15-labeled recombinant protein (NP_054760) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SPCS1 (Signal Peptidase Complex Subunit 1) is a Protein Coding gene. Diseases associated with SPCS1 include Japanese Encephalitis and Encephalitis. Among its related pathways are Viral mRNA Translation and Gene Expression. Gene Ontology (GO) annotations related to this gene include peptidase activity and ribosome binding.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 12 kDa
• AA Sequence: MLEHLSSLPTQMDYKGQKLAEQMFQGIILFSAIVGFIYGYVAEQFGWTVYIVMAGFAFSCLAQLTLPPWPIYRRHPLKWLPVQESSTDDKKPGERKIKRHAKNNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPCS1 signal peptidase complex subunit 1 [ Homo sapiens (human) ]
• Official Symbol: SPCS1
• Synonyms: SPCS1; signal peptidase complex subunit 1 homolog (S. cerevisiae); signal peptidase complex subunit 1; HSPC033; SPC1; SPC12; YJR010C A; SPase 12 kDa subunit; signal peptidase 12kDa; microsomal signal peptidase 12 kDa subunit; YJR010C-A
• Gene ID: 28972
• mRNA Refseq: NM_014041
• Protein Refseq: NP_054760
• MIM: 610358
• UniProt ID: Q9Y6A9