Recombinant Human SPARC Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SPARC-6051H |
Product Overview : | SPARC MS Standard C13 and N15-labeled recombinant protein (NP_003109) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a cysteine-rich acidic matrix-associated protein. The encoded protein is required for the collagen in bone to become calcified but is also involved in extracellular matrix synthesis and promotion of changes to cell shape. The gene product has been associated with tumor suppression but has also been correlated with metastasis based on changes to cell shape which can promote tumor cell invasion. Three transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 34.6 kDa |
AA Sequence : | MRAWIFFLLCLAGRALAAPQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SPARC secreted protein acidic and cysteine rich [ Homo sapiens (human) ] |
Official Symbol | SPARC |
Synonyms | SPARC; secreted protein, acidic, cysteine-rich (osteonectin); ON; cysteine rich protein; osteonectin; BM-40; cysteine-rich protein; basement-membrane protein 40; secreted protein acidic and rich in cysteine; |
Gene ID | 6678 |
mRNA Refseq | NM_003118 |
Protein Refseq | NP_003109 |
MIM | 182120 |
UniProt ID | P09486 |
◆ Recombinant Proteins | ||
SPARC-102H | Recombinant Human SPARC protein, His-tagged | +Inquiry |
SPARC-2503H | Recombinant Full Length Human SPARC Protein, MYC/DDK-tagged | +Inquiry |
SPARC-4111H | Recombinant Human SPARC Protein, His (Fc)-Avi-tagged | +Inquiry |
SPARC-1676C | Recombinant Cynomolgus SPARC protein, His-tagged | +Inquiry |
SPARC-7700R | Recombinant Rabbit SPARC protein, His & T7-tagged | +Inquiry |
◆ Native Proteins | ||
SPARC-30653TH | Native Human SPARC | +Inquiry |
SPARC-287B | Native Bovine Osteonectin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SPARC-2616HCL | Recombinant Human SPARC cell lysate | +Inquiry |
SPARC-2120MCL | Recombinant Mouse SPARC cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SPARC Products
Required fields are marked with *
My Review for All SPARC Products
Required fields are marked with *
0
Inquiry Basket