Recombinant Human SOWAHD Protein, MYC/DDK-tagged, C13 and N15-labeled

Cat.No. : SOWAHD-136H
Product Overview : ANKRD58 MS Standard C13 and N15-labeled recombinant protein (NP_001099046) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SOWAHD (Sosondowah Ankyrin Repeat Domain Family Member D) is a Protein Coding gene. An important paralog of this gene is SOWAHA.
Molecular Mass : 33.6 kDa
AA Sequence : MAQLGGAANRAPTASLAPTSQSLRCAPQPRPSRADTGSLGRYWGKAAAAASREHPFPGTLMHSAAGSGRRRGALRELLGLQRAAPAGWLSEERAEELGGPSGPGSSRLCLEPREHAWILAAAEGRYEVLRELLEAEPELLLRGDPITGYSVLHWLAKHGRHEELILVHDFALRRGLRLDVSAPGSGGLTPLHLAALQGHDMVIKVLVGALGADATRRDHSGHRACHYLRPDAPWRLRELSGAEEWEMESGSGCTNLNNNSSGTTAWRAASAVGATAVETSRRVAASRTKAKDTAGSRVAQMHSLFRHLFPSFQDRSGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SOWAHD sosondowah ankyrin repeat domain family member D [ Homo sapiens (human) ]
Official Symbol SOWAHD
Synonyms SOWAHD; sosondowah ankyrin repeat domain family member D; ANKRD58; ankyrin repeat domain-containing protein SOWAHD; ankyrin repeat domain 58; ankyrin repeat domain-containing protein 58; protein sosondowah homolog D
Gene ID 347454
mRNA Refseq NM_001105576
Protein Refseq NP_001099046
UniProt ID A6NJG2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SOWAHD Products

Required fields are marked with *

My Review for All SOWAHD Products

Required fields are marked with *

0

Inquiry Basket

cartIcon