Recombinant Human SOST Protein, His-tagged

• Cat.No.: SOST-04H
• Product Overview: Recombinant human SOST/Sclerostin (24-213 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 200
• Description: Sclerostin is a secreted glycoprotein with a C-terminal cysteine knot-like (CTCK) domain and sequence similarity to the DAN (differential screening-selected gene aberrative in neuroblastoma) family of bone morphogenetic protein (BMP) antagonists. Loss-of-function mutations in this gene are associated with an autosomal-recessive disorder, sclerosteosis, which causes progressive bone overgrowth. A deletion downstream of this gene, which causes reduced sclerostin expression, is associated with a milder form of the disorder called van Buchem disease.
• Form: Liquid
• Molecular Mass: 22.7 kDa
• AA Sequence: QGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 95% by SDS-PAGE
• Applications: SDS-PAGE
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Concentration: 0.25 mg/mL (determined by Bradford assay)
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 30% glycerol

Gene Information

• Gene Name: SOST sclerostin [ Homo sapiens (human) ]
• Official Symbol: SOST
• Synonyms: SOST; sclerostin; CDD; VBCH; DAND6; SOST1; sclerostin
• Gene ID: 50964
• mRNA Refseq: NM_025237
• Protein Refseq: NP_079513
• MIM: 605740
• UniProt ID: Q9BQB4