Recombinant Human SNX20 protein, GST-tagged

Cat.No. : SNX20-3512H
Product Overview : Recombinant Human SNX20 protein(Q7Z614)(1-102aa), fused to N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-102aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 38.4 kDa
AA Sequence : MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name SNX20 sorting nexin 20 [ Homo sapiens ]
Official Symbol SNX20
Synonyms SNX20; sorting nexin 20; sorting nexin-20; selectin ligand interactor cytoplasmic 1; SLIC 1; SLIC1; selectin ligand interactor cytoplasmic-1; selectin ligand-interactor cytoplasmic 1; MGC35578;
Gene ID 124460
mRNA Refseq NM_001144972
Protein Refseq NP_001138444
MIM 613281
UniProt ID Q7Z614

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNX20 Products

Required fields are marked with *

My Review for All SNX20 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon