Recombinant Human SNX20 protein, GST-tagged

• Cat.No.: SNX20-3512H
• Product Overview: Recombinant Human SNX20 protein(Q7Z614)(1-102aa), fused to N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-102aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 38.4 kDa
• AA Sequence: MASPEHPGSPGCMGPITQCTARTQQEAPATGPDLPHPGPDGHLDTHSGLSSNSSMTTRELQQYWQNQKCRWKHVKLLFEIASARIEERKVSKFVVYQIIVIQ
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SNX20 sorting nexin 20 [ Homo sapiens ]
• Official Symbol: SNX20
• Synonyms: SNX20; sorting nexin 20; sorting nexin-20; selectin ligand interactor cytoplasmic 1; SLIC 1; SLIC1; selectin ligand interactor cytoplasmic-1; selectin ligand-interactor cytoplasmic 1; MGC35578
• Gene ID: 124460
• mRNA Refseq: NM_001144972
• Protein Refseq: NP_001138444
• MIM: 613281
• UniProt ID: Q7Z614