Recombinant Human SNU13 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNU13-5334H
• Product Overview: NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_004999) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 14.2 kDa
• AA Sequence: MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLVSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNU13 small nuclear ribonucleoprotein 13 [ Homo sapiens (human) ]
• Official Symbol: SNU13
• Synonyms: SNU13; small nuclear ribonucleoprotein 13; FA1; FA-1; NHPX; 15.5K; OTK27; SSFA1; NHP2L1; SPAG12; SNRNP15-5; NHP2-like protein 1; NHP2 non-histone chromosome protein 2-like 1; SNU13 homolog, small nuclear ribonucleoprotein (U4/U6.U5); U4/U6.U5 tri-snRNP 15.5 kDa protein; [U4/U6.U5] tri-snRNP 15.5 kD RNA binding protein; high mobility group-like nuclear protein 2 homolog 1; non-histone chromosome protein 2-like 1; sperm specific antigen 1
• Gene ID: 4809
• mRNA Refseq: NM_005008
• Protein Refseq: NP_004999
• MIM: 601304
• UniProt ID: P55769