Recombinant Human SNRPD3 protein(11-100 aa), N-MBP & C-His-tagged

Cat.No. : SNRPD3-2804H
Product Overview : Recombinant Human SNRPD3 protein(P62318)(11-100 aa), fused with N-terminal MBP tag and C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&MBP
Protein Length : 11-100 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : HEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKA
Gene Name SNRPD3 small nuclear ribonucleoprotein D3 polypeptide 18kDa [ Homo sapiens ]
Official Symbol SNRPD3
Synonyms SMD3; Sm-D3
Gene ID 6634
mRNA Refseq NM_004175.3
Protein Refseq NP_004166.1
MIM 601062
UniProt ID P62318

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SNRPD3 Products

Required fields are marked with *

My Review for All SNRPD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon