Recombinant Human SNCG protein(11-120 aa), C-His-tagged

• Cat.No.: SNCG-2488H
• Product Overview: Recombinant Human SNCG protein(O76070)(11-120 aa), fused with C-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 11-120 aa
• Form: 0.15 M Phosphate buffered saline
• Storage: Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
  Up to 12 months when aliquoted and stored at -20 to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: AKEGVVGAVEKTKQGVTEAAEKTKEGVMYVGAKTKENVVQSVTSVAEKTKEQANAVSEAVVSSVNTVATKTVEEAENIAVTSGVVRKEDLRPSAPQQEGEASKEKEEVAE

Gene Information

• Gene Name: SNCG synuclein, gamma (breast cancer-specific protein 1) [ Homo sapiens ]
• Official Symbol: SNCG
• Synonyms: SNCG; synuclein, gamma (breast cancer-specific protein 1); gamma-synuclein; BCSG1; persyn; SR; synoretin; breast cancer-specific gene 1 protein
• Gene ID: 6623
• mRNA Refseq: NM_003087
• Protein Refseq: NP_003078
• MIM: 602998
• UniProt ID: O76070