Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SNCB-5006H
• Product Overview: SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 14.3 kDa
• AA Sequence: MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SNCB synuclein beta [ Homo sapiens (human) ]
• Official Symbol: SNCB
• Synonyms: SNCB; synuclein, beta; beta-synuclein
• Gene ID: 6620
• mRNA Refseq: NM_003085
• Protein Refseq: NP_003076
• MIM: 602569
• UniProt ID: Q16143