Recombinant Human SNCB Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SNCB-5006H |
Product Overview : | SNCB MS Standard C13 and N15-labeled recombinant protein (NP_003076) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of a small family of proteins that inhibit phospholipase D2 and may function in neuronal plasticity. The encoded protein is abundant in lesions of patients with Alzheimer disease. A mutation in this gene was found in individuals with dementia with Lewy bodies. Alternative splicing results in multiple transcript variants. |
Molecular Mass : | 14.3 kDa |
AA Sequence : | MDVFMKGLSMAKEGVVAAAEKTKQGVTEAAEKTKEGVLYVGSKTREGVVQGVASVAEKTKEQASHLGGAVFSGAGNIAAATGLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYEPEATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SNCB synuclein beta [ Homo sapiens (human) ] |
Official Symbol | SNCB |
Synonyms | SNCB; synuclein, beta; beta-synuclein; |
Gene ID | 6620 |
mRNA Refseq | NM_003085 |
Protein Refseq | NP_003076 |
MIM | 602569 |
UniProt ID | Q16143 |
◆ Recombinant Proteins | ||
SNCB-1294HFL | Recombinant Full Length Human SNCB Protein, C-Flag-tagged | +Inquiry |
SNCB-4366R | Recombinant Rhesus monkey SNCB Protein, His-tagged | +Inquiry |
SNCB-2879H | Recombinant Human SNCB protein(1-134aa), His&Myc-tagged | +Inquiry |
SNCB-84H | Recombinant Human Synuclein, Beta | +Inquiry |
SNCB-2839H | Recombinant Human SNCB, GST-tagged | +Inquiry |
◆ Native Proteins | ||
SNCB-27206TH | Native Human SNCB | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNCB-1631HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
SNCB-1632HCL | Recombinant Human SNCB 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNCB Products
Required fields are marked with *
My Review for All SNCB Products
Required fields are marked with *
0
Inquiry Basket