Recombinant Human SNAPC1 protein, His-tagged
Cat.No. : | SNAPC1-3163H |
Product Overview : | Recombinant Human SNAPC1 protein(58-368 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 58-368 aa |
AA Sequence : | ALALAWRYFLPPYTFQIRVGALYLLYGLYNTQLCQPKQKIRVALKDWDEVLKFQQDLVNAQHFDAAYIFRKLRLDRAFHFTAMPKLLSYRMKKKIHRAEVTEEFKDPSDRVMKLITSDVLEEMLNVHDHYQNMKHVISVDKSKPDKALSLIKDDFFDNIKNIVLEHQQWHKDRKNPSLKSKTNDGEEKMEGNSQETERCERAESLAKIKSKAFSVVIQASKSRRHRQVKLDSSDSDSASGQGQVKATRKKEKKERLKPAGRKMSLRNKGNVQNIHKEDKPLSLSMPVITEEEENESLSGTEFTASKKRRKH |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SNAPC1 small nuclear RNA activating complex, polypeptide 1, 43kDa [ Homo sapiens ] |
Official Symbol | SNAPC1 |
Synonyms | SNAPC1; small nuclear RNA activating complex, polypeptide 1, 43kDa; small nuclear RNA activating complex, polypeptide 1, 43kD; snRNA-activating protein complex subunit 1; PTFgamma; SNAP43; SNAPc subunit 1; PTF subunit gamma; SNAPc 43 kDa subunit; PSE-binding factor subunit gamma; snRNA-activating protein complex 43 kDa subunit; small nuclear RNA-activating complex polypeptide 1; proximal sequence element-binding transcription factor subunit gamma; |
Gene ID | 6617 |
mRNA Refseq | NM_003082 |
Protein Refseq | NP_003073 |
MIM | 600591 |
UniProt ID | Q16533 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SNAPC1 Products
Required fields are marked with *
My Review for All SNAPC1 Products
Required fields are marked with *
0
Inquiry Basket