Recombinant Human SNAI2, GST-tagged

• Cat.No.: SNAI2-175H
• Product Overview: Recombinant Human SNAI2 (97 a.a. - 169 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.

Specification

• Cat. No.: SNAI2-175H
• Description: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
• Source: wheat germ
• Molecular Mass: 33.77 kDa
• Sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
• Purification: Glutathione Sepharose 4 Fast Flow
• Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Applications: ELISA; WB
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Note: Best use within three months from the date of receipt of this protein.
• OfficialSymbol: SNAI2

Gene Information

• Gene Name: SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ]
• Synonyms: SLUG; WS2D; SLUGH1; SNAIL2; zinc finger protein SNAI2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; snail homolog 2 (Drosophila); Neural crest transcription factor Slug; Protein snail homolog 2; slug homolog, zinc finger protein (chicken); SLUGH
• Gene ID: 6591
• mRNA Refseq: NM_003068
• Protein Refseq: NP_003059
• MIM: 602150
• UniProt ID: O43623
• Chromosome Location: 8q11
• Pathway: Adherens junction; Direct p53 effectors; Neural Crest Differentiation; Regulation of Wnt-mediated beta catenin signaling and target gene transcription; Signaling events mediated by Stem cell factor receptor (c-Kit)
• Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding; sequence-specific DNA binding; zinc ion binding