Recombinant Human SMO, StrepII-tagged
Cat.No. : | SMO-211H |
Product Overview : | Purified, full-length human recombinant Smoothened homolog protein or SMO protein (amino acids 32-233, 202 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22.3 kDa. (Accession NP_005622.1; UniProt Q99835) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 32-233, 202 a.a. |
Description : | This product is the N-terminal extracellular domain of smoothened homolog (SMO). Native SMO is a G protein-coupled receptor that associates with the patched protein (PTCH) to transduce the hedgehog"s proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEA HGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEG CTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSY |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | SMO smoothened, frizzled family receptor [ Homo sapiens ] |
Official Symbol | SMO |
Synonyms | SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11; protein Gx; seven transmembrane helix receptor; smoothened, seven transmembrane spanning receptor; Gx; SMOH; |
Gene ID | 6608 |
mRNA Refseq | NM_005631 |
Protein Refseq | NP_005622 |
MIM | 601500 |
UniProt ID | Q99835 |
Chromosome Location | 7q32.1 |
Pathway | Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem; |
Function | G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding; patched binding; protein binding; receptor activity; signal transducer activity; |
◆ Recombinant Proteins | ||
SMO-31421TH | Recombinant Human SMO | +Inquiry |
SMO-314H | Active Recombinant Human SMO Full Length Transmembrane protein(VLPs) | +Inquiry |
SMO-31423TH | Recombinant Human SMO | +Inquiry |
SMO-5623R | Recombinant Rat SMO Protein | +Inquiry |
RFL28574MF | Recombinant Full Length Mouse Smoothened Homolog(Smo) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SMO Products
Required fields are marked with *
My Review for All SMO Products
Required fields are marked with *
0
Inquiry Basket