Recombinant Human SMO, StrepII-tagged

• Cat.No.: SMO-211H
• Product Overview: Purified, full-length human recombinant Smoothened homolog protein or SMO protein (amino acids 32-233, 202 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 22.3 kDa. (Accession NP_005622.1; UniProt Q99835)

Specification

• Description: This product is the N-terminal extracellular domain of smoothened homolog (SMO). Native SMO is a G protein-coupled receptor that associates with the patched protein (PTCH) to transduce the hedgehog"s proteins signal. Binding of sonic hedgehog (SHH) to its receptor patched is thought to prevent normal inhibition by patched of smoothened (SMO). Required for the accumulation of KIF7 and GLI3 in the cilia.
• Source: Human Cells
• Species: Human
• Tag: StrepII
• Form: Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free).
• Protein length: 32-233, 202 a.a.
• AA Sequence: RGAASSGNATGPGPRSAGGSARRSAAVTGPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEA HGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCAIVERERGWPDFLRCTPDRFPEG CTNEVQNIKFNSSGQCEVPLVRTDNPKSWYEDVEGCGIQCQNPLFTEAEHQDMHSY
• Endotoxin: <0.1 eu per ug protein by lal
• Purity: >95% pure by SDS-PAGE
• Storage: 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles.
• Reconstitution: Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml.

Gene Information

• Gene Name: SMO smoothened, frizzled family receptor [ Homo sapiens ]
• Official Symbol: SMO
• Synonyms: SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11; protein Gx; seven transmembrane helix receptor; smoothened, seven transmembrane spanning receptor; Gx; SMOH
• Gene ID: 6608
• mRNA Refseq: NM_005631
• Protein Refseq: NP_005622
• MIM: 601500
• UniProt ID: Q99835
• Chromosome Location: 7q32.1
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem; Hedgehog Signaling Pathway, organism-specific biosystem; Hedgehog signaling events mediated by Gli proteins, organism-specific biosystem
• Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding; patched binding; protein binding; receptor activity; signal transducer activity