Recombinant Human SMO

• Cat.No.: SMO-31421TH
• Product Overview: Recombinant fragment corresponding to amino acids 56-155 of Human Smoothened with proprietary tag; Predicted MWt 36.63 kDa.

Specification

• Description: The protein encoded by this gene is a G protein-coupled receptor that interacts with the patched protein, a receptor for hedgehog proteins. The encoded protein tranduces signals to other proteins after activation by a hedgehog protein/patched protein complex.
• Protein length: 100 amino acids
• Molecular Weight: 36.630kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: GPPPPLSHCGRAAPCEPLRYNVCLGSVLPYGATSTLLAGDSDSQEEAHGKLVLWSGLRNAPRCWAVIQPLLCAVYMPKCENDRVELPSRTLCQATRGPCA
• Sequence Similarities: Belongs to the G-protein coupled receptor Fz/Smo family.Contains 1 FZ (frizzled) domain.
• Tag: Non

Gene Information

• Gene Name: SMO smoothened, frizzled family receptor [ Homo sapiens ]
• Official Symbol: SMO
• Synonyms: SMO; smoothened, frizzled family receptor; SMOH, smoothened (Drosophila) homolog , smoothened homolog (Drosophila) , smoothened, seven transmembrane spanning receptor; smoothened homolog; frizzled family member 11; FZD11
• Gene ID: 6608
• mRNA Refseq: NM_005631
• Protein Refseq: NP_005622
• MIM: 601500
• Uniprot ID: Q99835
• Chromosome Location: 7q32.1
• Pathway: Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Class B/2 (Secretin family receptors), organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Other, organism-specific biosystem
• Function: G-protein coupled receptor activity; PDZ domain binding; Wnt-activated receptor activity; Wnt-protein binding; drug binding