Recombinant Human SMNDC1, His-tagged

• Cat.No.: SMNDC1-31197TH
• Product Overview: Recombinant full length Human SMNDC1 with an N terminal His tag ; predicted mwt: 28.9 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 238 amino acids
• Description: This gene is a paralog of SMN1 gene, which encodes the survival motor neuron protein, mutations in which are cause of autosomal recessive proximal spinal muscular atrophy. The protein encoded by this gene is a nuclear protein that has been identified as a constituent of the spliceosome complex. This gene is differentially expressed, with abundant levels in skeletal muscle, and may share similar cellular function as the SMN1 gene.
• Conjugation: HIS
• Molecular Weight: 28.900kDa inclusive of tags
• Form: Liquid
• Purity: >90% by SDS-PAGE
• Storage buffer: Preservative: NoneConstituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
• Sequences of amino acids: MGSSHHHHHHSSGLVPRGSHMSEDLAKQLASYKAQLQQVEAALSGNGENEDLLKLKKDLQEVIELTKDLLSTQPSETLASSDSFASTQPTHSWKVGDKCMAVWSEDGQCYEAEIEEIDEENGTAAITFAGYGNAEVTPLLNLKPVEEGRKAKEDSGNKPMSKKEMIAQQREYKKKKALKKAQRIKELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQ

Gene Information

• Gene Name: SMNDC1 survival motor neuron domain containing 1 [ Homo sapiens ]
• Official Symbol: SMNDC1
• Synonyms: SMNDC1; survival motor neuron domain containing 1; survival of motor neuron-related-splicing factor 30; SMNR; SPF30; splicing factor 30; survival of motor neuron related
• Gene ID: 10285
• mRNA Refseq: NM_005871
• Protein Refseq: NP_005862
• MIM: 603519
• Uniprot ID: O75940
• Chromosome Location: 10q23
• Pathway: Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem
• Function: RNA binding; protein binding