Recombinant Human SMCO4 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMCO4-4084H
• Product Overview: C11orf75 MS Standard C13 and N15-labeled recombinant protein (NP_064564) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: SMCO4 (Single-Pass Membrane Protein With Coiled-Coil Domains 4) is a Protein Coding gene. Diseases associated with SMCO4 include Febrile Seizures, Familial, 1 and Familial Febrile Seizures.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 6.7 kDa
• AA Sequence: MRQLKGKPKKETSKDKKERKQAMQEARQQITTVVLPTLAVVVLLIVVFVYVATRPTITETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMCO4 single-pass membrane protein with coiled-coil domains 4 [ Homo sapiens (human) ]
• Official Symbol: SMCO4
• Synonyms: SMCO4; single-pass membrane protein with coiled-coil domains 4; FN5; C11orf75; single-pass membrane and coiled-coil domain-containing protein 4; UPF0443 protein C11orf75
• Gene ID: 56935
• mRNA Refseq: NM_020179
• Protein Refseq: NP_064564
• MIM: 609477
• UniProt ID: Q9NRQ5