Recombinant Human SMCO3 Protein, MYC/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMCO3-367H
• Product Overview: C12orf69 MS Standard C13 and N15-labeled recombinant protein (NP_001013720) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Description: Low expression observed in reference dataset.
• Source: HEK293
• Species: Human
• Tag: Myc&DDK
• Molecular Mass: 24.7 kDa
• AA Sequence: MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINSETPNEMNSRFICHTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ]
• Official Symbol: SMCO3
• Synonyms: SMCO3; single-pass membrane protein with coiled-coil domains 3; C12orf69; single-pass membrane and coiled-coil domain-containing protein 3
• Gene ID: 440087
• mRNA Refseq: NM_001013698
• Protein Refseq: NP_001013720
• UniProt ID: A2RU48