Source :	Wheat Germ
Species :	Human
Form :	25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass :	24.8 kDa
AA Sequence :	MAQSDFLYPENPKRREEVNRLHQQLLDCLSDSFDVTNKLTEVLNMHLGCRLASIEMKRDGTIKENCDLIIQAIMKIQKELQKVDEALKDKLEPTLYRKLQDIKEKETDKIAIVQKVISVILGEATSAASAVAVKLVGSNVTTGIINKLVTVLAQIGASLLGSIGVAVLGLGIDMIVRAILGAVEKTQLQAAIKSYEKHLVEFKSASEKYNHAITEVINTVKHQMK
Usage :	Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Storage :	Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer :	25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Tag :	Non

Gene Name	SMCO3 single-pass membrane protein with coiled-coil domains 3 [ Homo sapiens (human) ]
Official Symbol	SMCO3
Synonyms	C12orf69
Gene ID	440087
mRNA Refseq	NM_001013698.2
Protein Refseq	NP_001013720.2
UniProt ID	A2RU48.1

ACE2-735H	Recombinant Human ACE2 Protein, His-tagged	+Inquiry
FGF10-15H	Active Recombinant Human FGF10 protein	+Inquiry
KITLG-19H	Active Recombinant Human KITLG Protein, Pre-aliquoted	+Inquiry
DEFB1-17H	Active Recombinant Human DEFB1 protein(1-47aa)	+Inquiry
DEFB4-18H	Active Recombinant Human DEFB4 protein(1-50aa)	+Inquiry