Recombinant Human SMAD3 protein, His-tagged

Cat.No. : SMAD3-2256H
Product Overview : Recombinant Human SMAD3 protein(P84022)( 1-425aa), fused to N-terminal His tag, was expressed in Insect Cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 1-425aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 50.6 kDa
AA Sequence : MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVNTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIRCSSVS
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name SMAD3 SMAD family member 3 [ Homo sapiens ]
Official Symbol SMAD3
Synonyms SMAD3; SMAD family member 3; MAD, mothers against decapentaplegic homolog 3 (Drosophila) , MADH3, SMAD, mothers against DPP homolog 3 (Drosophila); mothers against decapentaplegic homolog 3; HsT17436; JV15 2; mad3; hMAD-3; hSMAD3; MAD homolog 3; mad homolog JV15-2; mad protein homolog; mothers against DPP homolog 3; SMA- and MAD-related protein 3; SMAD, mothers against DPP homolog 3; MAD, mothers against decapentaplegic homolog 3; LDS1C; MADH3; JV15-2; HSPC193; MGC60396; DKFZp586N0721; DKFZp686J10186;
Gene ID 4088
mRNA Refseq NM_001145102
Protein Refseq NP_001138574
MIM 603109
UniProt ID P84022

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SMAD3 Products

Required fields are marked with *

My Review for All SMAD3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon