Recombinant Human SLCO2B1 protein, His&Myc-tagged

• Cat.No.: SLCO2B1-3502H
• Product Overview: Recombinant Human SLCO2B1 protein(O94956)(461-564aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&Myc
• Protein Length: 461-564aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 18.4 kDa
• AA Sequence: FFIGCSSHQIAGITHQTSAHPGLELSPSCMEACSCPLDGFNPVCDPSTRVEYITPCHAGCSSWVVQDALDNSQVFYTNCSCVVEGNPVLAGSCDSTCSHLVVPF
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.

Gene Information

• Gene Name: SLCO2B1 solute carrier organic anion transporter family, member 2B1 [ Homo sapiens ]
• Official Symbol: SLCO2B1
• Synonyms: SLCO2B1; solute carrier organic anion transporter family, member 2B1; SLC21A9, solute carrier family 21 (organic anion transporter), member 9; solute carrier organic anion transporter family member 2B1; OATP B; OATP2B1; OATP-RP2; organic anion transporter B; organic anion transporter polypeptide-related protein 2; solute carrier family 21 (organic anion transporter), member 9; OATPB; OATP-B; SLC21A9; KIAA0880; DKFZp686E0517
• Gene ID: 11309
• mRNA Refseq: NM_001145211
• Protein Refseq: NP_001138683
• MIM: 604988
• UniProt ID: O94956