Recombinant Human SLC7A5 protein, His-SUMO&Myc-tagged

Cat.No. : SLC7A5-4562H
Product Overview : Recombinant Human SLC7A5 protein(Q01650)(16-50aa), fused to N-terminal His tag and SUMO tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&Myc&SUMO
Protein Length : 16-50aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 18.0 kDa
AA Sequence : AEEKEEAREKMLAAKSADGSAPAGEGEGVTLQRNI
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name SLC7A5 solute carrier family 7 (amino acid transporter light chain, L system), member 5 [ Homo sapiens ]
Official Symbol SLC7A5
Synonyms SLC7A5; solute carrier family 7 (amino acid transporter light chain, L system), member 5; large neutral amino acids transporter small subunit 1; CD98; D16S469E; E16; LAT1; MPE16; 4F2 LC; 4F2 light chain; CD98 light chain; integral membrane protein E16; L-type amino acid transporter 1; solute carrier family 7 member 5; large neutral amino acids transporter 1; y+ system cationic amino acid transporter; sodium-independent neutral amino acid transporter LAT1; solute carrier family 7 (cationic amino acid transporter, y+ system), member 5; 4F2LC; hLAT1;
Gene ID 8140
mRNA Refseq NM_003486
Protein Refseq NP_003477
MIM 600182
UniProt ID Q01650

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC7A5 Products

Required fields are marked with *

My Review for All SLC7A5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon