Recombinant Human SLC6A3

Cat.No. : SLC6A3-26889TH
Product Overview : Recombinant fragment corresponding to amino acids 161-237 of Human Dopamine Transporter with proprietary tag; Predicted MWt 34.10 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 77 amino acids
Description : This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3 UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
Molecular Weight : 34.100kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR
Sequence Similarities : Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A3 subfamily.
Gene Name SLC6A3 solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 [ Homo sapiens ]
Official Symbol SLC6A3
Synonyms SLC6A3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; DAT1; sodium-dependent dopamine transporter; DAT; dopamine transporter;
Gene ID 6531
mRNA Refseq NM_001044
Protein Refseq NP_001035
MIM 126455
Uniprot ID Q01959
Chromosome Location 5p15.3
Pathway Alpha-synuclein signaling, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Monoamine Transport, organism-specific biosystem;
Function dopamine binding; dopamine transmembrane transporter activity; dopamine:sodium symporter activity; drug binding; monoamine transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All SLC6A3 Products

Required fields are marked with *

My Review for All SLC6A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon