Recombinant Human SLC6A3

• Cat.No.: SLC6A3-26889TH
• Product Overview: Recombinant fragment corresponding to amino acids 161-237 of Human Dopamine Transporter with proprietary tag; Predicted MWt 34.10 kDa.

Specification

• Description: This gene encodes a dopamine transporter which is a member of the sodium- and chloride-dependent neurotransmitter transporter family. The 3 UTR of this gene contains a 40 bp tandem repeat, referred to as a variable number tandem repeat or VNTR, which can be present in 3 to 11 copies. Variation in the number of repeats is associated with idiopathic epilepsy, attention-deficit hyperactivity disorder, dependence on alcohol and cocaine, susceptibility to Parkinson disease and protection against nicotine dependence.
• Protein length: 77 amino acids
• Molecular Weight: 34.100kDa inclusive of tags
• Source: Wheat germ
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: AWALHYLFSSFTTELPWIHCNNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPR
• Sequence Similarities: Belongs to the sodium:neurotransmitter symporter (SNF) (TC 2.A.22) family. SLC6A3 subfamily.
• Tag: Non

Gene Information

• Gene Name: SLC6A3 solute carrier family 6 (neurotransmitter transporter, dopamine), member 3 [ Homo sapiens ]
• Official Symbol: SLC6A3
• Synonyms: SLC6A3; solute carrier family 6 (neurotransmitter transporter, dopamine), member 3; DAT1; sodium-dependent dopamine transporter; DAT; dopamine transporter
• Gene ID: 6531
• mRNA Refseq: NM_001044
• Protein Refseq: NP_001035
• MIM: 126455
• Uniprot ID: Q01959
• Chromosome Location: 5p15.3
• Pathway: Alpha-synuclein signaling, organism-specific biosystem; Dopamine clearance from the synaptic cleft, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Monoamine Transport, organism-specific biosystem
• Function: dopamine binding; dopamine transmembrane transporter activity; dopamine:sodium symporter activity; drug binding; monoamine transmembrane transporter activity